![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (39 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [225413] (1 PDB entry) |
![]() | Domain d2rcvb1: 2rcv B:2-92 [206060] Other proteins in same PDB: d2rcva2, d2rcvb2, d2rcvc2, d2rcvd2, d2rcve2, d2rcvf2, d2rcvg2, d2rcvh2 automated match to d1dt0a1 complexed with mn |
PDB Entry: 2rcv (more details), 1.6 Å
SCOPe Domain Sequences for d2rcvb1:
Sequence, based on SEQRES records: (download)
>d2rcvb1 a.2.11.0 (B:2-92) automated matches {Bacillus subtilis [TaxId: 1423]} ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavegntalanksveelvadl dsvpenirtavrnnggghanhklfwtllspn
>d2rcvb1 a.2.11.0 (B:2-92) automated matches {Bacillus subtilis [TaxId: 1423]} ayelpelpyaydalephidketmtihhtkhhntyvtnlnkavtalanksveelvadldsv penirtavrnnggghanhklfwtllspn
Timeline for d2rcvb1: