Lineage for d2rc6b2 (2rc6 B:159-314)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2859932Species Leptospira interrogans [TaxId:173] [225434] (2 PDB entries)
  8. 2859938Domain d2rc6b2: 2rc6 B:159-314 [206053]
    Other proteins in same PDB: d2rc6a1, d2rc6b1, d2rc6c1, d2rc6d1
    automated match to d1qufa2
    complexed with fad, nap, so4, zn

Details for d2rc6b2

PDB Entry: 2rc6 (more details), 2.7 Å

PDB Description: Refined structure of FNR from Leptospira interrogans bound to NADP+
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d2rc6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rc6b2 c.25.1.0 (B:159-314) automated matches {Leptospira interrogans [TaxId: 173]}
lpntdfsgdimflatgtgiapfigmseellehklikftgnitlvygapysdelvmmdylk
gleskhknfklitaisreeknsfdggrmyishrvreqaeavkkilngggrfyicggpkgm
ekgvieeiqkisgntgtyeefkhhlegahqlfvety

SCOPe Domain Coordinates for d2rc6b2:

Click to download the PDB-style file with coordinates for d2rc6b2.
(The format of our PDB-style files is described here.)

Timeline for d2rc6b2: