Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (12 species) not a true protein |
Species Leptospira interrogans [TaxId:173] [225434] (2 PDB entries) |
Domain d2rc5d2: 2rc5 D:159-314 [206049] Other proteins in same PDB: d2rc5a1, d2rc5b1, d2rc5c1, d2rc5d1 automated match to d1qufa2 complexed with fad, so4, zn |
PDB Entry: 2rc5 (more details), 2.43 Å
SCOPe Domain Sequences for d2rc5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rc5d2 c.25.1.0 (D:159-314) automated matches {Leptospira interrogans [TaxId: 173]} lpntdfsgdimflatgtgiapfigmseellehklikftgnitlvygapysdelvmmdylk gleskhknfklitaisreeknsfdggrmyishrvreqaeavkkilngggrfyicggpkgm ekgvieeiqkisgntgtyeefkhhlegahqlfvety
Timeline for d2rc5d2: