Lineage for d2ra6d_ (2ra6 D:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1325025Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 1325026Protein automated matches [190698] (10 species)
    not a true protein
  7. 1325074Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries)
  8. 1325078Domain d2ra6d_: 2ra6 D: [206041]
    automated match to d1obpa_
    complexed with cl, ety, ipa, zn

Details for d2ra6d_

PDB Entry: 2ra6 (more details), 1.5 Å

PDB Description: crystal structure of the possum milk whey lipocalin trichosurin at ph 4.6 with bound 4-ethylphenol
PDB Compounds: (D:) Trichosurin

SCOPe Domain Sequences for d2ra6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra6d_ b.60.1.0 (D:) automated matches {Trichosurus vulpecula [TaxId: 9337]}
lsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltafkt
eearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikkrf
eedfmnrgfrrenildisevdhc

SCOPe Domain Coordinates for d2ra6d_:

Click to download the PDB-style file with coordinates for d2ra6d_.
(The format of our PDB-style files is described here.)

Timeline for d2ra6d_: