Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (10 species) not a true protein |
Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries) |
Domain d2ra6d_: 2ra6 D: [206041] automated match to d1obpa_ complexed with cl, ety, ipa, zn |
PDB Entry: 2ra6 (more details), 1.5 Å
SCOPe Domain Sequences for d2ra6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra6d_ b.60.1.0 (D:) automated matches {Trichosurus vulpecula [TaxId: 9337]} lsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltafkt eearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikkrf eedfmnrgfrrenildisevdhc
Timeline for d2ra6d_: