SCOPe 2.06: Domain d2ra6c_: 2ra6 C:

Lineage for d2ra6c_ (2ra6 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries)

8. Domain d2ra6c_: 2ra6 C: [206040]
   automated match to d1obpa_
   complexed with cl, ety, ipa, zn

Details for d2ra6c_

PDB Entry: 2ra6, 1.5 Å

PDB Description: crystal structure of the possum milk whey lipocalin trichosurin at ph 4.6 with bound 4-ethylphenol

PDB Compounds: (C:) Trichosurin

SCOPe Domain Sequences for d2ra6c_:

Sequence; same for both SEQRES and ATOM records:

>d2ra6c_ b.60.1.0 (C:) automated matches {Trichosurus vulpecula [TaxId: 9337]}
lsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltafkt
eearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikkrf
eedfmnrgfrrenildisevdhc

Timeline for d2ra6c_:

• d2ra6c_ first appeared in SCOPe 2.03
  
• d2ra6c_ appears in SCOPe 2.05
  
• d2ra6c_ appears in SCOPe 2.07
  
• d2ra6c_ appears in the current release, SCOPe 2.08