![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
![]() | Protein automated matches [190698] (25 species) not a true protein |
![]() | Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries) |
![]() | Domain d2ra6c_: 2ra6 C: [206040] automated match to d1obpa_ complexed with cl, ety, ipa, zn |
PDB Entry: 2ra6 (more details), 1.5 Å
SCOPe Domain Sequences for d2ra6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ra6c_ b.60.1.0 (C:) automated matches {Trichosurus vulpecula [TaxId: 9337]} lsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltafkt eearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikkrf eedfmnrgfrrenildisevdhc
Timeline for d2ra6c_: