Lineage for d2ra6c_ (2ra6 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805768Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries)
  8. 2805771Domain d2ra6c_: 2ra6 C: [206040]
    automated match to d1obpa_
    complexed with cl, ety, ipa, zn

Details for d2ra6c_

PDB Entry: 2ra6 (more details), 1.5 Å

PDB Description: crystal structure of the possum milk whey lipocalin trichosurin at ph 4.6 with bound 4-ethylphenol
PDB Compounds: (C:) Trichosurin

SCOPe Domain Sequences for d2ra6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra6c_ b.60.1.0 (C:) automated matches {Trichosurus vulpecula [TaxId: 9337]}
lsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplyltafkt
eearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneikkrf
eedfmnrgfrrenildisevdhc

SCOPe Domain Coordinates for d2ra6c_:

Click to download the PDB-style file with coordinates for d2ra6c_.
(The format of our PDB-style files is described here.)

Timeline for d2ra6c_: