SCOP 1.61: Domain d1b6db1: 1b6d B:1-107

Lineage for d1b6db1 (1b6d B:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Bence-Jones kappa L chain DEL (human) [48932] (1 PDB entry)

8. Domain d1b6db1: 1b6d B:1-107 [20604]
   Other proteins in same PDB: d1b6da2, d1b6db2

Details for d1b6db1

PDB Entry: 1b6d, 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6db1:

Sequence; same for both SEQRES and ATOM records:

>d1b6db1 b.1.1.1 (B:1-107) Immunoglobulin (variable domains of L and H chains) {Bence-Jones kappa L chain DEL (human)}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik

Timeline for d1b6db1:

• d1b6db1 first appeared (with stable ids) in SCOP 1.55
  
• d1b6db1 appears in SCOP 1.59
  
• d1b6db1 appears in SCOP 1.63
  
• d1b6db1 appears in the current release, SCOPe 2.08