Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Bence-Jones kappa L chain DEL (human) [48932] (1 PDB entry) |
Domain d1b6db1: 1b6d B:1-107 [20604] Other proteins in same PDB: d1b6da2, d1b6db2 |
PDB Entry: 1b6d (more details), 2.74 Å
SCOP Domain Sequences for d1b6db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6db1 b.1.1.1 (B:1-107) Immunoglobulin (variable domains of L and H chains) {Bence-Jones kappa L chain DEL (human)} diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik
Timeline for d1b6db1: