Lineage for d1b6db1 (1b6d B:1-107)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7201Species Bence-Jones kappa L chain DEL (human) [48932] (1 PDB entry)
  8. 7203Domain d1b6db1: 1b6d B:1-107 [20604]
    Other proteins in same PDB: d1b6da2, d1b6db2

Details for d1b6db1

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer

SCOP Domain Sequences for d1b6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6db1 b.1.1.1 (B:1-107) Immunoglobulin (variable domains of L and H chains) {Bence-Jones kappa L chain DEL (human)}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik

SCOP Domain Coordinates for d1b6db1:

Click to download the PDB-style file with coordinates for d1b6db1.
(The format of our PDB-style files is described here.)

Timeline for d1b6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6db2