![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Escherichia coli [TaxId:217992] [225533] (2 PDB entries) |
![]() | Domain d2r8zi_: 2r8z I: [206030] automated match to d3n07d_ complexed with ca, po4 |
PDB Entry: 2r8z (more details), 2.1 Å
SCOPe Domain Sequences for d2r8zi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8zi_ c.108.1.0 (I:) automated matches {Escherichia coli [TaxId: 217992]} latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs i
Timeline for d2r8zi_: