Lineage for d2r8zi_ (2r8z I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920399Species Escherichia coli [TaxId:217992] [225533] (2 PDB entries)
  8. 2920416Domain d2r8zi_: 2r8z I: [206030]
    automated match to d3n07d_
    complexed with ca, po4

Details for d2r8zi_

PDB Entry: 2r8z (more details), 2.1 Å

PDB Description: Crystal structure of YrbI phosphatase from Escherichia coli in complex with a phosphate and a calcium ion
PDB Compounds: (I:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d2r8zi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8zi_ c.108.1.0 (I:) automated matches {Escherichia coli [TaxId: 217992]}
latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
i

SCOPe Domain Coordinates for d2r8zi_:

Click to download the PDB-style file with coordinates for d2r8zi_.
(The format of our PDB-style files is described here.)

Timeline for d2r8zi_: