Lineage for d1b6da1 (1b6d A:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363471Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 363498Domain d1b6da1: 1b6d A:1-107 [20603]
    Other proteins in same PDB: d1b6da2, d1b6db2

Details for d1b6da1

PDB Entry: 1b6d (more details), 2.74 Å

PDB Description: bence jones protein del: an entire immunoglobulin kappa light-chain dimer
PDB Compounds: (A:)

SCOP Domain Sequences for d1b6da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6da1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik

SCOP Domain Coordinates for d1b6da1:

Click to download the PDB-style file with coordinates for d1b6da1.
(The format of our PDB-style files is described here.)

Timeline for d1b6da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b6da2