| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Bence-Jones kappa L chain DEL (human) [48932] (1 PDB entry) |
| Domain d1b6da1: 1b6d A:1-107 [20603] Other proteins in same PDB: d1b6da2, d1b6db2 |
PDB Entry: 1b6d (more details), 2.74 Å
SCOP Domain Sequences for d1b6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6da1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Bence-Jones kappa L chain DEL (human)}
diqmtqspsslsasvgdrvtitcqasqdissylnwyqqkpgkapkllihaassletgvps
rfsgsgsgtdfsftisslqpedlatyycqqydslpltfgggtkveik
Timeline for d1b6da1: