Lineage for d1mcww1 (1mcw W:1-111)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52613Species Heterologous L chain dimer MCG-WEIR hybrid (human) [48931] (1 PDB entry)
  8. 52615Domain d1mcww1: 1mcw W:1-111 [20602]
    Other proteins in same PDB: d1mcwm2, d1mcww2

Details for d1mcww1

PDB Entry: 1mcw (more details), 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity

SCOP Domain Sequences for d1mcww1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcww1 b.1.1.1 (W:1-111) Immunoglobulin (variable domains of L and H chains) {Heterologous L chain dimer MCG-WEIR hybrid (human)}
esaltqpasvsgspgqsitvscaghtsdvadsnsiswfqqhpdkapklliyavtfrpsgi
plrfsgsksgntasltisgllpddeadyfcmsylsdasfvfgsgtkvtvlr

SCOP Domain Coordinates for d1mcww1:

Click to download the PDB-style file with coordinates for d1mcww1.
(The format of our PDB-style files is described here.)

Timeline for d1mcww1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcww2