Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Heterologous L chain dimer MCG-WEIR hybrid (human) [48931] (1 PDB entry) |
Domain d1mcww1: 1mcw W:1-111 [20602] Other proteins in same PDB: d1mcwm2, d1mcww2 |
PDB Entry: 1mcw (more details), 3.5 Å
SCOP Domain Sequences for d1mcww1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mcww1 b.1.1.1 (W:1-111) Immunoglobulin (variable domains of L and H chains) {Heterologous L chain dimer MCG-WEIR hybrid (human)} esaltqpasvsgspgqsitvscaghtsdvadsnsiswfqqhpdkapklliyavtfrpsgi plrfsgsksgntasltisgllpddeadyfcmsylsdasfvfgsgtkvtvlr
Timeline for d1mcww1: