Lineage for d2r8yk_ (2r8y K:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920426Species Escherichia coli [TaxId:562] [225534] (4 PDB entries)
  8. 2920437Domain d2r8yk_: 2r8y K: [206016]
    automated match to d3n07d_
    complexed with ca, cl

Details for d2r8yk_

PDB Entry: 2r8y (more details), 1.85 Å

PDB Description: Crystal structure of YrbI phosphatase from Escherichia coli in a complex with Ca
PDB Compounds: (K:) YrbI from Escherichia coli

SCOPe Domain Sequences for d2r8yk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8yk_ c.108.1.0 (K:) automated matches {Escherichia coli [TaxId: 562]}
latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
i

SCOPe Domain Coordinates for d2r8yk_:

Click to download the PDB-style file with coordinates for d2r8yk_.
(The format of our PDB-style files is described here.)

Timeline for d2r8yk_: