Lineage for d1mcwm1 (1mcw M:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741646Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 2741688Domain d1mcwm1: 1mcw M:1-111 [20601]
    Other proteins in same PDB: d1mcwm2, d1mcww2
    part of heterologous L chain dimer MCG-WEIR

Details for d1mcwm1

PDB Entry: 1mcw (more details), 3.5 Å

PDB Description: three-dimensional structure of a hybrid light chain dimer. protein engineering of a binding cavity
PDB Compounds: (M:) immunoglobulin mcg (light chain)

SCOPe Domain Sequences for d1mcwm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcwm1 b.1.1.1 (M:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOPe Domain Coordinates for d1mcwm1:

Click to download the PDB-style file with coordinates for d1mcwm1.
(The format of our PDB-style files is described here.)

Timeline for d1mcwm1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcwm2