| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
| Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
| Protein automated matches [190447] (55 species) not a true protein |
| Species Escherichia coli [TaxId:562] [225534] (4 PDB entries) |
| Domain d2r8yd_: 2r8y D: [206009] automated match to d3n07d_ complexed with ca, cl |
PDB Entry: 2r8y (more details), 1.85 Å
SCOPe Domain Sequences for d2r8yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8yd_ c.108.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
i
Timeline for d2r8yd_: