Lineage for d2r8xi_ (2r8x I:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1628591Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1628592Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1629211Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1629212Protein automated matches [190447] (45 species)
    not a true protein
  7. 1629360Species Escherichia coli [TaxId:562] [225534] (4 PDB entries)
  8. 1629388Domain d2r8xi_: 2r8x I: [205998]
    automated match to d3n07d_
    complexed with cl

Details for d2r8xi_

PDB Entry: 2r8x (more details), 2.6 Å

PDB Description: Crystal structure of YrbI phosphatase from Escherichia coli
PDB Compounds: (I:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d2r8xi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r8xi_ c.108.1.0 (I:) automated matches {Escherichia coli [TaxId: 562]}
latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
i

SCOPe Domain Coordinates for d2r8xi_:

Click to download the PDB-style file with coordinates for d2r8xi_.
(The format of our PDB-style files is described here.)

Timeline for d2r8xi_: