Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Aquifex aeolicus [TaxId:63363] [225491] (1 PDB entry) |
Domain d2r7512: 2r75 1:205-330 [205981] Other proteins in same PDB: d2r7511 automated match to d1rq2a2 complexed with 01g, mg |
PDB Entry: 2r75 (more details), 1.4 Å
SCOPe Domain Sequences for d2r7512:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7512 d.79.2.1 (1:205-330) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 63363]} vdfadvrttleegglsiigmgegrgdekadiavekavtspllegntiegarrllvtiwts edipydivdevmerihskvhpeaeiifgavlepqeqdfirvaivatdfpeekfqvgekev kfkvik
Timeline for d2r7512: