Lineage for d2r7512 (2r75 1:205-330)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1657767Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1657768Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1657769Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1657772Species Aquifex aeolicus [TaxId:63363] [225491] (1 PDB entry)
  8. 1657773Domain d2r7512: 2r75 1:205-330 [205981]
    Other proteins in same PDB: d2r7511
    automated match to d1rq2a2
    complexed with 01g, mg

Details for d2r7512

PDB Entry: 2r75 (more details), 1.4 Å

PDB Description: Aquifex aeolicus FtsZ with 8-morpholino-GTP
PDB Compounds: (1:) cell division protein ftsz

SCOPe Domain Sequences for d2r7512:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7512 d.79.2.1 (1:205-330) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 63363]}
vdfadvrttleegglsiigmgegrgdekadiavekavtspllegntiegarrllvtiwts
edipydivdevmerihskvhpeaeiifgavlepqeqdfirvaivatdfpeekfqvgekev
kfkvik

SCOPe Domain Coordinates for d2r7512:

Click to download the PDB-style file with coordinates for d2r7512.
(The format of our PDB-style files is described here.)

Timeline for d2r7512:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7511