Lineage for d2r7511 (2r75 1:8-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863172Species Aquifex aeolicus [TaxId:63363] [225490] (1 PDB entry)
  8. 2863173Domain d2r7511: 2r75 1:8-204 [205980]
    Other proteins in same PDB: d2r7512
    automated match to d1rq2a1
    complexed with 01g, mg

Details for d2r7511

PDB Entry: 2r75 (more details), 1.4 Å

PDB Description: Aquifex aeolicus FtsZ with 8-morpholino-GTP
PDB Compounds: (1:) cell division protein ftsz

SCOPe Domain Sequences for d2r7511:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7511 c.32.1.1 (1:8-204) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 63363]}
ckikvigvggggsnavnrmyedgiegvelyaintdvqhlstlkvpnkiqigekvtrglga
gakpevgeeaaledidkikeilrdtdmvfisaglgggtgtgaapviaktakemgiltvav
atlpfrfegprkmekalkgleklkessdayivihndkikelsnrtltikdafkevdsvls
kavrgitsivvtpavin

SCOPe Domain Coordinates for d2r7511:

Click to download the PDB-style file with coordinates for d2r7511.
(The format of our PDB-style files is described here.)

Timeline for d2r7511:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r7512