SCOPe 2.07: Domain d1a8jh1: 1a8j H:1-111

Lineage for d1a8jh1 (1a8j H:1-111)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)

8. Domain d1a8jh1: 1a8j H:1-111 [20598]
   Other proteins in same PDB: d1a8jh2, d1a8jl2
   part of the antibody MCG light chain dimer
   complexed with pme

Details for d1a8jh1

PDB Entry: 1a8j, 2.7 Å

PDB Description: immunoglobulin lambda light chain dimer (mcg) complex with aspartame

PDB Compounds: (H:) immunoglobulin lambda light chain dimer (mcg)

SCOPe Domain Sequences for d1a8jh1:

Sequence; same for both SEQRES and ATOM records:

>d1a8jh1 b.1.1.1 (H:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1a8jh1:

• d1a8jh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a8jh1 appears in SCOPe 2.06
  
• d1a8jh1 appears in the current release, SCOPe 2.08