Lineage for d1a8jh1 (1a8j H:1-111)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288299Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 288338Domain d1a8jh1: 1a8j H:1-111 [20598]
    Other proteins in same PDB: d1a8jh2, d1a8jl2
    part of the antibody MCG light chain dimer
    complexed with pme

Details for d1a8jh1

PDB Entry: 1a8j (more details), 2.7 Å

PDB Description: immunoglobulin lambda light chain dimer (mcg) complex with aspartame

SCOP Domain Sequences for d1a8jh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8jh1 b.1.1.1 (H:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1a8jh1:

Click to download the PDB-style file with coordinates for d1a8jh1.
(The format of our PDB-style files is described here.)

Timeline for d1a8jh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8jh2