SCOP 1.63: Domain d1a8jh1: 1a8j H:1-111

Lineage for d1a8jh1 (1a8j H:1-111)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Lambda L chain dimer MCG (human) [48930] (18 PDB entries)

8. Domain d1a8jh1: 1a8j H:1-111 [20598]
   Other proteins in same PDB: d1a8jh2, d1a8jl2
   complexed with pme

Details for d1a8jh1

PDB Entry: 1a8j, 2.7 Å

PDB Description: immunoglobulin lambda light chain dimer (mcg) complex with aspartame

SCOP Domain Sequences for d1a8jh1:

Sequence; same for both SEQRES and ATOM records:

>d1a8jh1 b.1.1.1 (H:1-111) Immunoglobulin (variable domains of L and H chains) {Lambda L chain dimer MCG (human)}
esaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

Timeline for d1a8jh1:

• d1a8jh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a8jh1 appears in SCOP 1.61
  
• d1a8jh1 appears in SCOP 1.65
  
• d1a8jh1 appears in the current release, SCOPe 2.08