SCOPe 2.05: Domain d2r73a_: 2r73 A:

Lineage for d2r73a_ (2r73 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (16 species)
   not a true protein

7. Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries)

8. Domain d2r73a_: 2r73 A: [205974]
   automated match to d1obpa_

Details for d2r73a_

PDB Entry: 2r73, 2.5 Å

PDB Description: crystal structure of the possum milk whey lipocalin trichosurin at ph 8.2

PDB Compounds: (A:) Trichosurin

SCOPe Domain Sequences for d2r73a_:

Sequence; same for both SEQRES and ATOM records:

>d2r73a_ b.60.1.0 (A:) automated matches {Trichosurus vulpecula [TaxId: 9337]}
weqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplylta
fkteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneik
krfeedfmnrgfrrenildisevdhc

Timeline for d2r73a_:

• d2r73a_ first appeared in SCOPe 2.03
  
• d2r73a_ appears in SCOPe 2.04
  
• d2r73a_ appears in SCOPe 2.06
  
• d2r73a_ appears in the current release, SCOPe 2.08