Lineage for d2r73a_ (2r73 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396500Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2396501Protein automated matches [190698] (21 species)
    not a true protein
  7. 2396639Species Trichosurus vulpecula [TaxId:9337] [225383] (3 PDB entries)
  8. 2396646Domain d2r73a_: 2r73 A: [205974]
    automated match to d1obpa_

Details for d2r73a_

PDB Entry: 2r73 (more details), 2.5 Å

PDB Description: Crystal Structure of the Possum Milk Whey Lipocalin Trichosurin at pH 8.2
PDB Compounds: (A:) Trichosurin

SCOPe Domain Sequences for d2r73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r73a_ b.60.1.0 (A:) automated matches {Trichosurus vulpecula [TaxId: 9337]}
weqlsrhwhtvvlassdrslieeegpfrnfiqnitvesgnlngffltrkngqciplylta
fkteearqfklnyygtndvyyesskpneyakfifynyhdgkvnvvanlfgrtpnlsneik
krfeedfmnrgfrrenildisevdhc

SCOPe Domain Coordinates for d2r73a_:

Click to download the PDB-style file with coordinates for d2r73a_.
(The format of our PDB-style files is described here.)

Timeline for d2r73a_: