Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Aquifex aeolicus [TaxId:224324] [225358] (1 PDB entry) |
Domain d2r6r12: 2r6r 1:205-330 [205973] Other proteins in same PDB: d2r6r11 automated match to d1rq2a2 complexed with gdp |
PDB Entry: 2r6r (more details), 1.7 Å
SCOPe Domain Sequences for d2r6r12:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r6r12 d.79.2.1 (1:205-330) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 224324]} vdfadvrttleegglsiigmgegrgdekadiavekavtspllegntiegarrllvtiwts edipydivdevmerihskvhpeaeiifgavlepqeqdfirvaivatdfpeekfqvgekev kfkvik
Timeline for d2r6r12: