Lineage for d2r6r12 (2r6r 1:205-330)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Aquifex aeolicus [TaxId:224324] [225358] (1 PDB entry) 
Domain d2r6r12: 2r6r 1:205-330 [205973]
Other proteins in same PDB: d2r6r11
automated match to d1rq2a2
complexed with gdp
Details for d2r6r12
PDB Entry: 2r6r (more details), 1.7 Å
PDB Description: Aquifex aeolicus FtsZ
PDB Compounds: (1:) cell division protein ftszSCOPe Domain Sequences for d2r6r12:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r6r12 d.79.2.1 (1:205-330) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 224324]}
vdfadvrttleegglsiigmgegrgdekadiavekavtspllegntiegarrllvtiwts
edipydivdevmerihskvhpeaeiifgavlepqeqdfirvaivatdfpeekfqvgekev
kfkvik
SCOPe Domain Coordinates for d2r6r12:
Click to download the PDB-style file with coordinates for d2r6r12.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2r6r12:
- d2r6r12 first appeared in SCOPe 2.03
- d2r6r12 appears in SCOPe 2.06
- d2r6r12 appears in the current release, SCOPe 2.08
View in 3D
