Lineage for d2r6r12 (2r6r 1:205-330)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420834Species Aquifex aeolicus [TaxId:224324] [225358] (1 PDB entry)
  8. 1420835Domain d2r6r12: 2r6r 1:205-330 [205973]
    Other proteins in same PDB: d2r6r11
    automated match to d1rq2a2
    complexed with gdp

Details for d2r6r12

PDB Entry: 2r6r (more details), 1.7 Å

PDB Description: Aquifex aeolicus FtsZ
PDB Compounds: (1:) cell division protein ftsz

SCOPe Domain Sequences for d2r6r12:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6r12 d.79.2.1 (1:205-330) Cell-division protein FtsZ {Aquifex aeolicus [TaxId: 224324]}
vdfadvrttleegglsiigmgegrgdekadiavekavtspllegntiegarrllvtiwts
edipydivdevmerihskvhpeaeiifgavlepqeqdfirvaivatdfpeekfqvgekev
kfkvik

SCOPe Domain Coordinates for d2r6r12:

Click to download the PDB-style file with coordinates for d2r6r12.
(The format of our PDB-style files is described here.)

Timeline for d2r6r12:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r6r11