Lineage for d2r4va2 (2r4v A:98-245)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2326952Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2326953Protein automated matches [226831] (71 species)
    not a true protein
  7. 2327166Species Human (Homo sapiens) [TaxId:9606] [225003] (13 PDB entries)
  8. 2327182Domain d2r4va2: 2r4v A:98-245 [205969]
    Other proteins in same PDB: d2r4va1
    automated match to d1k0ma1
    complexed with gsh

Details for d2r4va2

PDB Entry: 2r4v (more details), 1.85 Å

PDB Description: Structure of human CLIC2, crystal form A
PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2r4va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r4va2 a.45.1.0 (A:98-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ryphlspkykesfdvgcnlfakfsayikntqkeanknfeksllkefkrlddylntpllde
idpdsaeeppvsrrlfldgdqltladcsllpklniikvaakkyrdfdipaefsgvwrylh
nayareefthtcpedkeientyanvakq

SCOPe Domain Coordinates for d2r4va2:

Click to download the PDB-style file with coordinates for d2r4va2.
(The format of our PDB-style files is described here.)

Timeline for d2r4va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r4va1