Class a: All alpha proteins [46456] (286 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (51 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225003] (11 PDB entries) |
Domain d2r4va2: 2r4v A:98-245 [205969] Other proteins in same PDB: d2r4va1 automated match to d1k0ma1 complexed with gsh |
PDB Entry: 2r4v (more details), 1.85 Å
SCOPe Domain Sequences for d2r4va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r4va2 a.45.1.0 (A:98-245) automated matches {Human (Homo sapiens) [TaxId: 9606]} ryphlspkykesfdvgcnlfakfsayikntqkeanknfeksllkefkrlddylntpllde idpdsaeeppvsrrlfldgdqltladcsllpklniikvaakkyrdfdipaefsgvwrylh nayareefthtcpedkeientyanvakq
Timeline for d2r4va2: