SCOPe 2.03: Domain d2r4va2: 2r4v A:98-245

Lineage for d2r4va2 (2r4v A:98-245)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225003] (10 PDB entries)

8. Domain d2r4va2: 2r4v A:98-245 [205969]
   Other proteins in same PDB: d2r4va1
   automated match to d1k0ma1
   complexed with gsh

Details for d2r4va2

PDB Entry: 2r4v, 1.85 Å

PDB Description: Structure of human CLIC2, crystal form A

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2r4va2:

Sequence; same for both SEQRES and ATOM records:

>d2r4va2 a.45.1.0 (A:98-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ryphlspkykesfdvgcnlfakfsayikntqkeanknfeksllkefkrlddylntpllde
idpdsaeeppvsrrlfldgdqltladcsllpklniikvaakkyrdfdipaefsgvwrylh
nayareefthtcpedkeientyanvakq

Timeline for d2r4va2:

• d2r4va2 is new in SCOPe 2.03-stable
  
• d2r4va2 appears in SCOPe 2.04
  
• d2r4va2 appears in the current release, SCOPe 2.08