SCOPe 2.08: Domain d2r4va1: 2r4v A:10-97

Lineage for d2r4va1 (2r4v A:10-97)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d2r4va1: 2r4v A:10-97 [205968]
   Other proteins in same PDB: d2r4va2
   automated match to d1k0ma2
   complexed with gsh

Details for d2r4va1

PDB Entry: 2r4v, 1.85 Å

PDB Description: Structure of human CLIC2, crystal form A

PDB Compounds: (A:) Chloride intracellular channel protein 2

SCOPe Domain Sequences for d2r4va1:

Sequence, based on SEQRES records:

>d2r4va1 c.47.1.0 (A:10-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmtrkpeelkdlapgtn
ppflvynkelktdfikieefleqtlapp

Sequence, based on observed residues (ATOM records):

>d2r4va1 c.47.1.0 (A:10-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdpeielfvkagsdgesigncpfcqrlfmilwlkgvkfnvttvdmtpgtnppflvynkel
ktdfikieefleqtlapp

Timeline for d2r4va1:

• d2r4va1 first appeared in SCOPe 2.03
  
• d2r4va1 appears in SCOPe 2.07