Lineage for d2r4hc1 (2r4h C:2-86)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2056895Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2056989Domain d2r4hc1: 2r4h C:2-86 [205967]
    Other proteins in same PDB: d2r4ha2, d2r4ha3, d2r4hb2, d2r4hc2, d2r4hc3
    automated match to d2q3gb_
    complexed with his; mutant

Details for d2r4hc1

PDB Entry: 2r4h (more details), 2.05 Å

PDB Description: crystal structure of a c1190s mutant of the 6th pdz domain of human membrane associated guanylate kinase
PDB Compounds: (C:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d2r4hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r4hc1 b.36.1.0 (C:2-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dfytvelergakgfgfslrggreynmdlyvlrlaedgpaersgkmrigdeileingettk
nmkhsraieliknggrrvrlflkrg

SCOPe Domain Coordinates for d2r4hc1:

Click to download the PDB-style file with coordinates for d2r4hc1.
(The format of our PDB-style files is described here.)

Timeline for d2r4hc1: