SCOPe 2.08: Domain d2r3vd2: 2r3v D:226-395

Lineage for d2r3vd2 (2r3v D:226-395)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families)
common fold is elaborated with additional secondary structures
Family d.58.26.3: Mevalonate kinase [75450] (1 protein)
Protein Mevalonate kinase [75451] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [225476] (1 PDB entry)
Domain d2r3vd2: 2r3v D:226-395 [205962]
Other proteins in same PDB: d2r3va1, d2r3vb1, d2r3vc1, d2r3vd1
automated match to d1kvka2

Details for d2r3vd2

PDB Entry: 2r3v (more details), 2.5 Å

PDB Description: The Biochemical and Structural Basis for Feedback Inhibition of Mevalonate Kinase and Isoprenoid Metabolism

PDB Compounds: (D:) Mevalonate Kinase

SCOPe Domain Sequences for d2r3vd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r3vd2 d.58.26.3 (D:226-395) Mevalonate kinase {Human (Homo sapiens) [TaxId: 9606]}
rspalqilltntkvprntralvagvrnrllkfpeivaplltsidaislecervlgemgea
papeqylvleelidmnqhhlnalgvghasldqlcqvtrarglhskltgaggggcgitllk
pgleqpeveatkqaltscgfdcletsigapgvsihsatsldsrvqqaldg

SCOPe Domain Coordinates for d2r3vd2:

Click to download the PDB-style file with coordinates for d2r3vd2.
(The format of our PDB-style files is described here.)

Timeline for d2r3vd2: