![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.3: Mevalonate kinase [75450] (1 protein) |
![]() | Protein Mevalonate kinase [75451] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225476] (1 PDB entry) |
![]() | Domain d2r3vc2: 2r3v C:226-395 [205960] Other proteins in same PDB: d2r3va1, d2r3vb1, d2r3vc1, d2r3vd1 automated match to d1kvka2 |
PDB Entry: 2r3v (more details), 2.5 Å
SCOPe Domain Sequences for d2r3vc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r3vc2 d.58.26.3 (C:226-395) Mevalonate kinase {Human (Homo sapiens) [TaxId: 9606]} rspalqilltntkvprntralvagvrnrllkfpeivaplltsidaislecervlgemgea papeqylvleelidmnqhhlnalgvghasldqlcqvtrarglhskltgaggggcgitllk pgleqpeveatkqaltscgfdcletsigapgvsihsatsldsrvqqaldg
Timeline for d2r3vc2: