Lineage for d1mcjb1 (1mcj B:1-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653767Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 653798Species Human (Homo sapiens), cluster 4 [TaxId:9606] [88539] (23 PDB entries)
  8. 653834Domain d1mcjb1: 1mcj B:1-111 [20596]
    Other proteins in same PDB: d1mcja2, d1mcjb2
    part of the antibody MCG light chain dimer
    complexed with nh2

Details for d1mcjb1

PDB Entry: 1mcj (more details), 2.7 Å

PDB Description: principles and pitfalls in designing site directed peptide ligands
PDB Compounds: (B:) immunoglobulin lambda dimer mcg (light chain)

SCOP Domain Sequences for d1mcjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcjb1 b.1.1.1 (B:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
psaltqppsasgslgqsvtisctgtssdvggynyvswyqqhagkapkviiyevnkrpsgv
pdrfsgsksgntasltvsglqaedeadyycssyegsdnfvfgtgtkvtvlg

SCOP Domain Coordinates for d1mcjb1:

Click to download the PDB-style file with coordinates for d1mcjb1.
(The format of our PDB-style files is described here.)

Timeline for d1mcjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mcjb2