Lineage for d2r3vc1 (2r3v C:2-225)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157803Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2157849Protein Mevalonate kinase [75353] (3 species)
  7. 2157850Species Human (Homo sapiens) [TaxId:9606] [225475] (1 PDB entry)
  8. 2157853Domain d2r3vc1: 2r3v C:2-225 [205959]
    Other proteins in same PDB: d2r3va2, d2r3vb2, d2r3vc2, d2r3vd2
    automated match to d1kvka1

Details for d2r3vc1

PDB Entry: 2r3v (more details), 2.5 Å

PDB Description: The Biochemical and Structural Basis for Feedback Inhibition of Mevalonate Kinase and Isoprenoid Metabolism
PDB Compounds: (C:) Mevalonate Kinase

SCOPe Domain Sequences for d2r3vc1:

Sequence, based on SEQRES records: (download)

>d2r3vc1 d.14.1.5 (C:2-225) Mevalonate kinase {Human (Homo sapiens) [TaxId: 9606]}
lsevllvsapgkvilhgehavvhgkvalavslnlrtflrlqphsngkvdlslpnigikra
wdvarlqsldtsfleqgdvttptseqveklkevaglpddcavterlavlaflylylsicr
kqralpsldivvwselppgaglgssaaysvclaaalltvceeipnplkdgdcvnrwtked
lelinkwafqgermihgnpsgvdnavstwggalryhqgkisslk

Sequence, based on observed residues (ATOM records): (download)

>d2r3vc1 d.14.1.5 (C:2-225) Mevalonate kinase {Human (Homo sapiens) [TaxId: 9606]}
lsevllvsapgkvilhgehavvhgkvalavslnlrtflrlqphsngkvdlslpnigikra
wdvarlqsldtsflvttptseqveklkevaglpddcavterlavlaflylylsicrkqra
lpsldivvwselppgaglgssaaysvclaaalltvceeipnplkdgdcvnrwtkedleli
nkwafqgermihgnpsgvdnavstwggalryhqgkisslk

SCOPe Domain Coordinates for d2r3vc1:

Click to download the PDB-style file with coordinates for d2r3vc1.
(The format of our PDB-style files is described here.)

Timeline for d2r3vc1: