Lineage for d2r2ia_ (2r2i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711609Species Chicken (Gallus gallus) [TaxId:9031] [225390] (1 PDB entry)
  8. 2711610Domain d2r2ia_: 2r2i A: [205954]
    automated match to d1s6ca_
    complexed with bme, ca, myr

Details for d2r2ia_

PDB Entry: 2r2i (more details), 2 Å

PDB Description: myristoylated guanylate cyclase activating protein-1 with calcium bound
PDB Compounds: (A:) Guanylyl cyclase-activating protein 1

SCOPe Domain Sequences for d2r2ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2ia_ a.39.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gnmdskaveelsatechqwykkfmtecpsgqltlyefkqffglknlspsankyveqmfet
fdfnkdgyidfmeyvaalslvlkgkvdqklrwyfklydvdgngcidrgellniikairai
nrcneamtaeeftnmvfdkidingdgelsleefmegvqkdevlldiltrsldlthivkli
qndg

SCOPe Domain Coordinates for d2r2ia_:

Click to download the PDB-style file with coordinates for d2r2ia_.
(The format of our PDB-style files is described here.)

Timeline for d2r2ia_: