![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [225390] (1 PDB entry) |
![]() | Domain d2r2ia_: 2r2i A: [205954] automated match to d1s6ca_ complexed with bme, ca, myr |
PDB Entry: 2r2i (more details), 2 Å
SCOPe Domain Sequences for d2r2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2ia_ a.39.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gnmdskaveelsatechqwykkfmtecpsgqltlyefkqffglknlspsankyveqmfet fdfnkdgyidfmeyvaalslvlkgkvdqklrwyfklydvdgngcidrgellniikairai nrcneamtaeeftnmvfdkidingdgelsleefmegvqkdevlldiltrsldlthivkli qndg
Timeline for d2r2ia_: