Lineage for d2r1xa2 (2r1x A:108-213)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293251Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1293486Species Mouse (Mus musculus) [TaxId:10090] [88567] (364 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1293499Domain d2r1xa2: 2r1x A:108-213 [205931]
    Other proteins in same PDB: d2r1xa1, d2r1xb1, d2r1xb2
    automated match to d3t65a2
    complexed with kda, kdd, mg, zn

Details for d2r1xa2

PDB Entry: 2r1x (more details), 1.6 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues
PDB Compounds: (A:) Fab, antibody fragment (IgG1k), light chain

SCOPe Domain Sequences for d2r1xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1xa2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2r1xa2:

Click to download the PDB-style file with coordinates for d2r1xa2.
(The format of our PDB-style files is described here.)

Timeline for d2r1xa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r1xa1