Lineage for d2r1wb2 (2r1w B:112-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760894Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1760922Domain d2r1wb2: 2r1w B:112-211 [205929]
    Other proteins in same PDB: d2r1wa1, d2r1wa2, d2r1wb1
    automated match to d3t65b2
    complexed with kda, kdb, mg, zn

Details for d2r1wb2

PDB Entry: 2r1w (more details), 1.7 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues
PDB Compounds: (B:) Fab, antibody fragment (IgG1k), heavy chain

SCOPe Domain Sequences for d2r1wb2:

Sequence, based on SEQRES records: (download)

>d2r1wb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2r1wb2 b.1.1.2 (B:112-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2r1wb2:

Click to download the PDB-style file with coordinates for d2r1wb2.
(The format of our PDB-style files is described here.)

Timeline for d2r1wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r1wb1