Lineage for d2r1wb1 (2r1w B:1-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2739990Domain d2r1wb1: 2r1w B:1-111 [205928]
    Other proteins in same PDB: d2r1wa1, d2r1wa2, d2r1wb2
    automated match to d3t65b1
    complexed with mg, zn

Details for d2r1wb1

PDB Entry: 2r1w (more details), 1.7 Å

PDB Description: crystal structure of s25-2 fab in complex with kdo analogues
PDB Compounds: (B:) Fab, antibody fragment (IgG1k), heavy chain

SCOPe Domain Sequences for d2r1wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1wb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

SCOPe Domain Coordinates for d2r1wb1:

Click to download the PDB-style file with coordinates for d2r1wb1.
(The format of our PDB-style files is described here.)

Timeline for d2r1wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r1wb2