Class a: All alpha proteins [46456] (289 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (30 PDB entries) |
Domain d2r0ob2: 2r0o B:161-271 [205923] Other proteins in same PDB: d2r0oa3, d2r0oa4, d2r0ob3, d2r0ob4 automated match to d1sh5a2 complexed with gol; mutant |
PDB Entry: 2r0o (more details), 2.2 Å
SCOPe Domain Sequences for d2r0ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0ob2 a.40.1.0 (B:161-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddp vtnlnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsga
Timeline for d2r0ob2:
View in 3D Domains from other chains: (mouse over for more information) d2r0oa1, d2r0oa2, d2r0oa3, d2r0oa4 |