Lineage for d2r0ob1 (2r0o B:44-160)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1269975Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1269976Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1270047Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1270048Protein automated matches [226856] (1 species)
    not a true protein
  7. 1270049Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries)
  8. 1270066Domain d2r0ob1: 2r0o B:44-160 [205922]
    automated match to d1sh5a1
    complexed with gol; mutant

Details for d2r0ob1

PDB Entry: 2r0o (more details), 2.2 Å

PDB Description: crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(k255e)
PDB Compounds: (B:) Alpha-actinin-4

SCOPe Domain Sequences for d2r0ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0ob1 a.40.1.0 (B:44-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefawekqqrktftawcnshlrkagtqienidedfrdglklmlllevisgerlpkpergk
mrvhkinnvnkaldfiaskgvklvsigaeeivdgnakmtlgmiwtiilrfaiqdisv

SCOPe Domain Coordinates for d2r0ob1:

Click to download the PDB-style file with coordinates for d2r0ob1.
(The format of our PDB-style files is described here.)

Timeline for d2r0ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0ob2