![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
![]() | Protein automated matches [226856] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries) |
![]() | Domain d2r0oa2: 2r0o A:161-271 [205921] Other proteins in same PDB: d2r0oa3, d2r0oa4, d2r0ob3, d2r0ob4 automated match to d1sh5a2 complexed with gol; mutant |
PDB Entry: 2r0o (more details), 2.2 Å
SCOPe Domain Sequences for d2r0oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0oa2 a.40.1.0 (A:161-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddp vtnlnnafevaekyldipkmldaedivntarpdeeaimtyvssfyhafsga
Timeline for d2r0oa2:
![]() Domains from other chains: (mouse over for more information) d2r0ob1, d2r0ob2, d2r0ob3, d2r0ob4 |