SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qzyb1 (2qzy B:34-278)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149702Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2149703Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2149787Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2149788Protein automated matches [226847] (5 species)
    not a true protein
  7. 2149794Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries)
  8. 2149800Domain d2qzyb1: 2qzy B:34-278 [205918]
    Other proteins in same PDB: d2qzya2, d2qzyb2
    automated match to d1khba2
    complexed with 20s, epe, mn, pep

Details for d2qzyb1

PDB Entry: 2qzy (more details), 1.9 Å

PDB Description: The structure of chicken mitochondrial PEPCK in complex with PEP
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d2qzyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzyb1 c.109.1.0 (B:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc
wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc
magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh
svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm
aqqqg

SCOPe Domain Coordinates for d2qzyb1:

Click to download the PDB-style file with coordinates for d2qzyb1.
(The format of our PDB-style files is described here.)

Timeline for d2qzyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qzyb2