Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) |
Family c.109.1.0: automated matches [227144] (1 protein) not a true family |
Protein automated matches [226847] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225083] (4 PDB entries) |
Domain d2qzya1: 2qzy A:34-278 [205916] Other proteins in same PDB: d2qzya2, d2qzyb2 automated match to d1khba2 complexed with epe, mn, pep |
PDB Entry: 2qzy (more details), 1.9 Å
SCOPe Domain Sequences for d2qzya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qzya1 c.109.1.0 (A:34-278) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lstslsalpaaardfveeavrlcrprevllcdgseeegkellrglqddgvlhplpkydnc wlartdprdvarvesktvlvtpeqsdavpppppsggppqlgnwmspnafqaavqerfpgc magrplyvipfsmgpptsplaklgvqvtdspyvvlsmrimtrvgpavlqrldddfvrclh svgrplplteplvsswpcdpsrvlvahipserrivsfgsgyggnsllgkkcfalriasrm aqqqg
Timeline for d2qzya1: