Lineage for d2qzjc_ (2qzj C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115182Species Clostridium difficile [TaxId:272563] [225325] (1 PDB entry)
  8. 2115185Domain d2qzjc_: 2qzj C: [205912]
    automated match to d2iynb_

Details for d2qzjc_

PDB Entry: 2qzj (more details), 2.89 Å

PDB Description: crystal structure of a two-component response regulator from clostridium difficile
PDB Compounds: (C:) Two-component response regulator

SCOPe Domain Sequences for d2qzjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzjc_ c.23.1.0 (C:) automated matches {Clostridium difficile [TaxId: 272563]}
qtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdg
wtlckkirnvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmn
s

SCOPe Domain Coordinates for d2qzjc_:

Click to download the PDB-style file with coordinates for d2qzjc_.
(The format of our PDB-style files is described here.)

Timeline for d2qzjc_: