Lineage for d2qzja_ (2qzj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2855909Species Clostridium difficile [TaxId:272563] [225325] (1 PDB entry)
  8. 2855910Domain d2qzja_: 2qzj A: [205910]
    automated match to d2iynb_

Details for d2qzja_

PDB Entry: 2qzj (more details), 2.89 Å

PDB Description: crystal structure of a two-component response regulator from clostridium difficile
PDB Compounds: (A:) Two-component response regulator

SCOPe Domain Sequences for d2qzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzja_ c.23.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
qtkiliidgdkdncqklkgfleekgisidlaynceeaigkifsnkydlifleiilsdgdg
wtlckkirnvttcpivymtyinedqsilnalnsggddylikplnleilyakvkailrrmn
s

SCOPe Domain Coordinates for d2qzja_:

Click to download the PDB-style file with coordinates for d2qzja_.
(The format of our PDB-style files is described here.)

Timeline for d2qzja_: