![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (9 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:273057] [225324] (1 PDB entry) |
![]() | Domain d2qzcb_: 2qzc B: [205909] automated match to d2gm7b_ complexed with gol, imd |
PDB Entry: 2qzc (more details), 1.5 Å
SCOPe Domain Sequences for d2qzcb_:
Sequence, based on SEQRES records: (download)
>d2qzcb_ a.132.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} gnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlralliassk gpidkvtkilnlvfssrdkglethgklyskldisrdvivktgynlinyaytrhlyyyanl dwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsit edllnifinsvrfeigfwdaslrkdptvy
>d2qzcb_ a.132.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} gnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlralliassk gpidkvtkilnlvfssethgklyskldisrdvivktgynlinyaytrhlyyyanldwnkf lvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsitedlln ifinsvrfeigfwdaslrkdptvy
Timeline for d2qzcb_: