Lineage for d2qzcb_ (2qzc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732860Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2732861Protein automated matches [190172] (9 species)
    not a true protein
  7. 2732912Species Sulfolobus solfataricus [TaxId:273057] [225324] (1 PDB entry)
  8. 2732914Domain d2qzcb_: 2qzc B: [205909]
    automated match to d2gm7b_
    complexed with gol, imd

Details for d2qzcb_

PDB Entry: 2qzc (more details), 1.5 Å

PDB Description: crystal structure of a putative tena-like thiaminase (tena-1, sso2206) from sulfolobus solfataricus p2 at 1.50 a resolution
PDB Compounds: (B:) Transcriptional activator TenA-1

SCOPe Domain Sequences for d2qzcb_:

Sequence, based on SEQRES records: (download)

>d2qzcb_ a.132.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
gnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlralliassk
gpidkvtkilnlvfssrdkglethgklyskldisrdvivktgynlinyaytrhlyyyanl
dwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsit
edllnifinsvrfeigfwdaslrkdptvy

Sequence, based on observed residues (ATOM records): (download)

>d2qzcb_ a.132.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
gnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlralliassk
gpidkvtkilnlvfssethgklyskldisrdvivktgynlinyaytrhlyyyanldwnkf
lvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsitedlln
ifinsvrfeigfwdaslrkdptvy

SCOPe Domain Coordinates for d2qzcb_:

Click to download the PDB-style file with coordinates for d2qzcb_.
(The format of our PDB-style files is described here.)

Timeline for d2qzcb_: