SCOPe 2.08: Domain d2qzca_: 2qzc A:

Lineage for d2qzca_ (2qzc A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [225324] (1 PDB entry)

8. Domain d2qzca_: 2qzc A: [205908]
   automated match to d2gm7b_
   complexed with gol, imd

Details for d2qzca_

PDB Entry: 2qzc, 1.5 Å

PDB Description: crystal structure of a putative tena-like thiaminase (tena-1, sso2206) from sulfolobus solfataricus p2 at 1.50 a resolution

PDB Compounds: (A:) Transcriptional activator TenA-1

SCOPe Domain Sequences for d2qzca_:

Sequence, based on SEQRES records:

>d2qzca_ a.132.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
ivgnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlrallias
skgpidkvtkilnlvfssrdkglethgklyskldisrdvivktgynlinyaytrhlyyya
nldwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevs
itedllnifinsvrfeigfwdaslrkdptvy

Sequence, based on observed residues (ATOM records):

>d2qzca_ a.132.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
ivgnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlrallias
skgpidkvtkilnlvfsskglethgklyskldisrdvivktgynlinyaytrhlyyyanl
dwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsit
edllnifinsvrfeigfwdaslrkdptvy

Timeline for d2qzca_:

• d2qzca_ first appeared in SCOPe 2.03
  
• d2qzca_ appears in SCOPe 2.07