Lineage for d2qzca_ (2qzc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011656Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2011657Protein automated matches [190172] (9 species)
    not a true protein
  7. 2011694Species Sulfolobus solfataricus [TaxId:273057] [225324] (1 PDB entry)
  8. 2011695Domain d2qzca_: 2qzc A: [205908]
    automated match to d2gm7b_
    complexed with gol, imd

Details for d2qzca_

PDB Entry: 2qzc (more details), 1.5 Å

PDB Description: crystal structure of a putative tena-like thiaminase (tena-1, sso2206) from sulfolobus solfataricus p2 at 1.50 a resolution
PDB Compounds: (A:) Transcriptional activator TenA-1

SCOPe Domain Sequences for d2qzca_:

Sequence, based on SEQRES records: (download)

>d2qzca_ a.132.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
ivgnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlrallias
skgpidkvtkilnlvfssrdkglethgklyskldisrdvivktgynlinyaytrhlyyya
nldwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevs
itedllnifinsvrfeigfwdaslrkdptvy

Sequence, based on observed residues (ATOM records): (download)

>d2qzca_ a.132.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
ivgnvenlingvgelwnkyvkhefilkmrdgslpldifryyliqdgkyvedmlrallias
skgpidkvtkilnlvfsskglethgklyskldisrdvivktgynlinyaytrhlyyyanl
dwnkflvawtpcmfgysivgdyvidspnevyktwasfyasteykkrieailyaldevsit
edllnifinsvrfeigfwdaslrkdptvy

SCOPe Domain Coordinates for d2qzca_:

Click to download the PDB-style file with coordinates for d2qzca_.
(The format of our PDB-style files is described here.)

Timeline for d2qzca_: