SCOPe 2.08: Domain d2qyob1: 2qyo B:6-113

Lineage for d2qyob1 (2qyo B:6-113)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [225107] (5 PDB entries)

8. Domain d2qyob1: 2qyo B:6-113 [205903]
   Other proteins in same PDB: d2qyoa2, d2qyob2
   automated match to d1fp2a1
   complexed with k, qso, sah

Details for d2qyob1

PDB Entry: 2qyo, 1.95 Å

PDB Description: crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah

PDB Compounds: (B:) O-methyltransferase

SCOPe Domain Sequences for d2qyob1:

Sequence; same for both SEQRES and ATOM records:

>d2qyob1 a.4.5.0 (B:6-113) automated matches {Medicago truncatula [TaxId: 3880]}
nnrkpseifkaqallyknmyafvdsmslkwsiemnipniihnhgkpitlsnlvsilqips
tkvdnvqrlmrylahngffeiitnqeleneeeayaltvasellvkgte

Timeline for d2qyob1:

• d2qyob1 first appeared in SCOPe 2.03
  
• d2qyob1 appears in SCOPe 2.07