Lineage for d2qyoa2 (2qyo A:114-357)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1378686Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 1378716Protein automated matches [226979] (2 species)
    not a true protein
  7. 1378726Species Medicago truncatula [TaxId:3880] [225509] (1 PDB entry)
  8. 1378727Domain d2qyoa2: 2qyo A:114-357 [205902]
    Other proteins in same PDB: d2qyoa1, d2qyob1
    automated match to d1fp2a2
    complexed with k, qso, sah

Details for d2qyoa2

PDB Entry: 2qyo (more details), 1.95 Å

PDB Description: crystal structure of isoflavone o-methyltransferase homolog in complex with biochanin a and sah
PDB Compounds: (A:) O-methyltransferase

SCOPe Domain Sequences for d2qyoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qyoa2 c.66.1.12 (A:114-357) automated matches {Medicago truncatula [TaxId: 3880]}
lclapmvecvldptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndal
asdskminlamkdcnlvfeglesivdvgggngttgkiicetfpkltcvvfdrpkvvenlc
gsnnltyvggdmfisvpkadavllkavlhdwtdkdcikilkkckeavtsdgkrgkvivid
mvinekkdenqltqikllmnvtiscvngkerneeewkklfieagfqdykispftglmsli
eiyp

SCOPe Domain Coordinates for d2qyoa2:

Click to download the PDB-style file with coordinates for d2qyoa2.
(The format of our PDB-style files is described here.)

Timeline for d2qyoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qyoa1