SCOPe 2.08: Domain d2qyca1: 2qyc A:1-101

Lineage for d2qyca1 (2qyc A:1-101)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:257310] [225323] (1 PDB entry)

8. Domain d2qyca1: 2qyc A:1-101 [205898]
   Other proteins in same PDB: d2qyca2, d2qycb2
   automated match to d1q4ra_
   complexed with act, cl, edo

Details for d2qyca1

PDB Entry: 2qyc, 1.9 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution

PDB Compounds: (A:) Ferredoxin-like protein

SCOPe Domain Sequences for d2qyca1:

Sequence; same for both SEQRES and ATOM records:

>d2qyca1 d.58.4.0 (A:1-101) automated matches {Bordetella bronchiseptica [TaxId: 257310]}
mtmflhvvmmefddgidagffrtvdeyvarmkrecdglllyhfgenvaarsqgythatss
afvdaaahdayqvcpahvamkafmgprikrvvvydgevpai

Timeline for d2qyca1:

• d2qyca1 first appeared in SCOPe 2.03, called d2qyca_
  
• d2qyca1 appears in SCOPe 2.07